20% OFF shipping at portesetfenetresplus.com on orders over $79 + up to 10% OFF products
/eh/2025-01-08/173633966714069467/picture.png)
/eh/2024-12-24/173503345348979036/Favorite-Icon.png){kind=icon}
/eh/2025-07-08/1751962110204480194/picture.png)
/eh/2025-06-21/1750485478958537574/countryInfoIcon.png)
/eh/2025-06-21/1750485741321434291/Hi-Sign-in-My-Nihao.png)
/eh/2025-06-21/1750485837193896318/cart.png)
/eh/2025-06-21/1750485968202533847/cart.png)
/eh/2025-04-17/1744862476612819675/hot-img.png)
/eh/2025-11-07/1762504524550532584/header-icon.jpg){kind=icon}
/eh/2025-07-07/1751875582852206790/header-icon.png){kind=icon}
/eh/2025-07-07/1751875587886277738/header-icon.png){kind=icon}
download picture
Shopping security
product description
Why choose thelockerguy wholesale?
biolab ghk-cu Shot:4 Shots
How BPC-157 Promotes Faster Bone Healing and Recovery?
Cagrilintide 5mg + Semaglutide 5mg Strength: 10mg CAS: Cagrilintide: 1415456-99-3 Semaglutide: 910463-68-2 Chemical Formula: Cagrilintide: C₁₉₄H₃₁₂N₅₄O₅₉S₂ Semaglutide: C₁₈₇H₂₉₁N₄₅O₅₉ Molecular weight: Cagrilintide:4409 g/mol Semaglutide: 4114 g/mol Peptide Sequence: Cagrilintide: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP Semaglutide: H-His-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys(AEEAc-AEEAc-γ-Glu-17-carboxyheptadecanoyl)-Glu-Phe-Ile-Ala-Trp-Leu-Val-Arg-Gly-OH Synonyms: CagriSema Storage: Store 2–8 °C (≤–20 °C long-term)
Sterile water Injection
Shot:4 Shots
Other medicinal products and VITAMIN B12 DELAGRANGE 1000 micrograms/2 ml, solution for injection (IM) and drinking Tell your doctor or pharmacist if you are taking, have recently taken or may take any other medicines, especially those used to reduce stomach acidity (gastric antisecretory drugs)
biolab ghk-cu Shot:4 Shots
Item no
:
58994530358
US$ 28.78
Pay in 4 interest-free payments of $7.20 Learn more
Min. order:
1piece
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Oct 12 - Oct 17
US$40
Get nowSign up to your membership to get coupons up to
15%
Get nowOpportunity to enjoy order discount up to 15% off
Please add the products
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
Frequently Asked Questions for biolab ghk-cu Shot:4 Shots
What should I do if a relevant policy link does not open?
Check whether the problem affects one link or several pages. Avoid supplying unnecessary personal information merely to request general terms.
How can I keep a support request clear when several people respond?
Keep your desired outcome clear without changing unrelated details. Keep a brief timeline if the case involves several stages.
What should I check if an offer requires a minimum purchase?
Check whether the minimum applies to one transaction only. Avoid submitting extra orders while an eligibility question remains unresolved.
You may also like
FocusNeeds™
US$ 23.33
L-Theanine 250mg
US$ 25.32
ACETYL-L-CARNITINE
US$ 23.89
Kids L-Theanine 50mg Chewable Tablets
US$ 25.06
Carnitine | Heart and brain health
US$ 26.44
CARNITINE (L-CARNITINE, ACETYLCARNITINE)
US$ 29.21